Crystal structure of product-like, processed n-terminal protease npro at ph 3
PDB DOI: 10.2210/pdb3zft/pdb
Classification: HYDROLASE Organism(s): Pestivirus Strain D32/00_Hobi
Deposited: 2012-12-12 Deposition Author(s): Auer, B. , Brandstetter, H. , Koll, M. , Schindler, S. , Schneider, R. , Sponring, M. , Zogg, T.
Crystal structure of product-like, processed n-terminal protease npro at ph 3
Auer, B. , Brandstetter, H. , Koll, M. , Schindler, S. , Schneider, R. , Sponring, M. , Zogg, T.
Primary Citation of Related Structures: 3ZFT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| N-TERMINAL PROTEASE NPRO | A | 148 | Pestivirus Strain D32/00_Hobi | MEPLYDKNGAVLFGEPSDTHPQSTLKLPHPRGEKEVIVGIRDLPRKGDCRTGNRLGPVSGLFVKPGPVFYQDYSGPVYHRAPLEQFKQAPMCEVTKRIGRVTGSDGNLYHMYVCTDGCILVKTAKREGQDVLKWVYNVLDSPIWVTSC |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-12-12 Deposition Author(s): Auer, B. , Brandstetter, H. , Koll, M. , Schindler, S. , Schneider, R. , Sponring, M. , Zogg, T.