Structure of a periplasmic fragment of tram
PDB DOI: 10.2210/pdb3wz3/pdb
Classification: UNKNOWN FUNCTION Organism(s): Plasmid R64
Deposited: 2014-09-18 Deposition Author(s): Imada, K. , Kubori, T. , Kuroda, T. , Nagai, H. , Uchida, Y.
Structure of a periplasmic fragment of tram
Imada, K. , Kubori, T. , Kuroda, T. , Nagai, H. , Uchida, Y.
Primary Citation of Related Structures: 3WZ3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TraM protein | A | 144 | Plasmid R64 | GSHMWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFAGYVNALQASNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPRLKPSGMEIRQMISRNAGPNS |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-09-18 Deposition Author(s): Imada, K. , Kubori, T. , Kuroda, T. , Nagai, H. , Uchida, Y.