Crystal structure of dodecamer human insulin with double c-axis length of the hexamer 2 zn insulin cell
PDB DOI: 10.2210/pdb3w80/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2013-03-11 Deposition Author(s): Murayoshi, M. , Sakabe, K. , Sakabe, N. , Sasaki, K.
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of dodecamer human insulin with double c-axis length of the hexamer 2 zn insulin cell
Murayoshi, M. , Sakabe, K. , Sakabe, N. , Sasaki, K.
Primary Citation of Related Structures: 3W80
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | E | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | G | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin | F | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin | H | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-11 Deposition Author(s): Murayoshi, M. , Sakabe, K. , Sakabe, N. , Sasaki, K.