0.92a structure of 2zn human insulin at 100k
PDB DOI: 10.2210/pdb3w7y/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2013-03-11 Deposition Author(s): Murayoshi, M. , Sakabe, K. , Sakabe, N. , Sasaki, K.
0.92a structure of 2zn human insulin at 100k
Murayoshi, M. , Sakabe, K. , Sakabe, N. , Sasaki, K.
Primary Citation of Related Structures: 3W7Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-11 Deposition Author(s): Murayoshi, M. , Sakabe, K. , Sakabe, N. , Sasaki, K.