Crystal structure of virb core domain complexed with the cis-acting site upstream icsb promoter
PDB DOI: 10.2210/pdb3w3c/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Shigella Flexneri 2A , Synthetic Construct
Deposited: 2012-12-19 Deposition Author(s): Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.
Crystal structure of virb core domain complexed with the cis-acting site upstream icsb promoter
Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.
Primary Citation of Related Structures: 3W3C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Virulence regulon transcriptional activator VirB | A | 143 | Shigella Flexneri 2A , Synthetic Construct | MGSSHHHHHHSSGLVPRGSHMAKEHSIRELGIGLNFLKVSGMSYKDIAKKENLSRAKVTRAFQAASVPQEIISLFPIASELNFNDYKILFNYYKGLEKANESLSSTLPILKEEIKDLDTNLPPDIYKKEILNIIKKSKNRKQN |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-12-19 Deposition Author(s): Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.