Crystal structure of dna uridine endonuclease mth212
PDB DOI: 10.2210/pdb3w2x/pdb
Classification: HYDROLASE Organism(s): Methanothermobacter Thermautotrophicus
Deposited: 2012-12-06 Deposition Author(s): Arai, R. , Shida, T. , Tabata, N.
Crystal structure of dna uridine endonuclease mth212
Arai, R. , Shida, T. , Tabata, N.
Primary Citation of Related Structures: 3W2X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Exodeoxyribonuclease | A | 260 | Methanothermobacter Thermautotrophicus | GSHMTVLKIISWNVNGLRAVHRKGFLKWFMEEKPDILCLQEIKAAPEQLPRKLRHVEGYRSFFTPAERKGYSGVAMYTKVPPSSLREGFGVERFDTEGRIQIADFDDFLLYNIYFPNGKMSEERLKYKLEFYDAFLEDVNRERDSGRNVIICGDFNTAHREIDLARPKENSNVSGFLPVERAWIDKFIENGYVDTFRMFNSDPGQYTWWSYRTRARERNVGWRLDYFFVNEEFKGKVKRSWILSDVMGSDHCPIGLEIEL |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-12-06 Deposition Author(s): Arai, R. , Shida, T. , Tabata, N.