Crystal structure of virb core domain complexed with the cis-acting site upstream icsp promoter
PDB DOI: 10.2210/pdb3w2a/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Enterobacteria Phage If1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-11-27 Deposition Author(s): Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.
Crystal structure of virb core domain complexed with the cis-acting site upstream icsp promoter
Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.
Primary Citation of Related Structures: 3W2A
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Virulence regulon transcriptional activator VirB | A | 143 | Enterobacteria Phage If1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPRGSHMAKEHSIRELGIGLNFLKVSGMSYKDIAKKENLSRAKVTRAFQAASVPQEIISLFPIASELNFNDYKILFNYYKGLEKANESLSSTLPILKEEIKDLDTNLPPDIYKKEILNIIKKSKNRKQN |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-11-27 Deposition Author(s): Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.