Crystal structure of virb core domain (se-met derivative) complexed with the cis-acting site (5-bru modifications) upstream icsb promoter
PDB DOI: 10.2210/pdb3vwb/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Enterobacteria Phage If1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-08-21 Deposition Author(s): Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.
Crystal structure of virb core domain (se-met derivative) complexed with the cis-acting site (5-bru modifications) upstream icsb promoter
Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.
Primary Citation of Related Structures: 3VWB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Virulence regulon transcriptional activator virB | A | 143 | Enterobacteria Phage If1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPRGSHMAKEHSIRELGIGLNFLKVSGMSYKDIAKKENLSRAKVTRAFQAASVPQEIISLFPIASELNFNDYKILFNYYKGLEKANESLSSTLPILKEEIKDLDTNLPPDIYKKEILNIIKKSKNRKQN |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-08-21 Deposition Author(s): Cui, S. , Gao, X.P. , Waltersperger, S. , Wang, M.T.