Both zn fingers of gata1 bound to palindromic dna recognition site, p21 crystal form
PDB DOI: 10.2210/pdb3vd6/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-01-04 Deposition Author(s): Guss, J.M. , Jacques, D.A. , Matthews, J.M. , Ripin, N. , Wilkinson-White, L.E.
Method: X-RAY DIFFRACTION Resolution: 1.98 Å
Both zn fingers of gata1 bound to palindromic dna recognition site, p21 crystal form
Guss, J.M. , Jacques, D.A. , Matthews, J.M. , Ripin, N. , Wilkinson-White, L.E.
Primary Citation of Related Structures: 3VD6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Erythroid transcription factor | C | 119 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-01-04 Deposition Author(s): Guss, J.M. , Jacques, D.A. , Matthews, J.M. , Ripin, N. , Wilkinson-White, L.E.