Crystal structure of nad kinase 1 h223e mutant from listeria monocytogenes in complex with 5'-amino-5'-deoxyadenosine
PDB DOI: 10.2210/pdb3v8q/pdb
Classification: TRANSFERASE Organism(s): Listeria Monocytogenes
Deposited: 2011-12-23 Deposition Author(s): Assairi, L. , Dugu, L. , Dussurget, O. , Gelin, M. , Huteau, V. , Labesse, G. , Morellato, L. , Pochet, S. , Poncet-Montange, G.
Crystal structure of nad kinase 1 h223e mutant from listeria monocytogenes in complex with 5'-amino-5'-deoxyadenosine
Assairi, L. , Dugu, L. , Dussurget, O. , Gelin, M. , Huteau, V. , Labesse, G. , Morellato, L. , Pochet, S. , Poncet-Montange, G.
Primary Citation of Related Structures: 3V8Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable inorganic polyphosphate/ATP-NAD kinase 1 | A | 272 | Listeria Monocytogenes | MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDELSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIEDLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-12-23 Deposition Author(s): Assairi, L. , Dugu, L. , Dussurget, O. , Gelin, M. , Huteau, V. , Labesse, G. , Morellato, L. , Pochet, S. , Poncet-Montange, G.