Kinetic and structural studies of thermostabilized mutants of hca ii.
PDB DOI: 10.2210/pdb3v3j/pdb
Classification: LYASE Organism(s): Homo Sapiens
Deposited: 2011-12-13 Deposition Author(s): Boone, C.D. , Fisher, S.Z. , Mckenna, R.
Kinetic and structural studies of thermostabilized mutants of hca ii.
Boone, C.D. , Fisher, S.Z. , Mckenna, R.
Primary Citation of Related Structures: 3V3J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carbonic anhydrase 2 | A | 260 | Homo Sapiens | MSHHWGFGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNLGHAFQVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNGEGEPEEPMVDNWRPAQPLKQRQIKASFK |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-12-13 Deposition Author(s): Boone, C.D. , Fisher, S.Z. , Mckenna, R.