Crystal structure of de novo designed mid1-cobalt
PDB DOI: 10.2210/pdb3v1d/pdb
Classification: DE NOVO PROTEIN, METAL BINDING PROTEIN Organism(s): Artificial Gene
Deposited: 2011-12-09 Deposition Author(s): Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.
Method: X-RAY DIFFRACTION Resolution: 1.239 Å
Crystal structure of de novo designed mid1-cobalt
Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.
Primary Citation of Related Structures: 3V1D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Computational design, MID1-cobalt | A | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
| Computational design, MID1-cobalt | B | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
| Computational design, MID1-cobalt | C | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
| Computational design, MID1-cobalt | D | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
| Computational design, MID1-cobalt | E | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
| Computational design, MID1-cobalt | F | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
| Computational design, MID1-cobalt | G | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
| Computational design, MID1-cobalt | H | 48 | Artificial Gene | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-12-09 Deposition Author(s): Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.