Crystal structure of de novo designed mid1-zinc
PDB DOI: 10.2210/pdb3v1c/pdb
Classification: DE NOVO PROTEIN, HYDROLASE Organism(s): Caulobacter Sp.
Deposited: 2011-12-09 Deposition Author(s): Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.
Crystal structure of de novo designed mid1-zinc
Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.
Primary Citation of Related Structures: 3V1C
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Computational design, MID1-zinc | A | 48 | Caulobacter Sp. | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
Computational design, MID1-zinc | B | 48 | Caulobacter Sp. | GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-12-09 Deposition Author(s): Der, B.S. , Kuhlman, B. , Machius, M. , Miley, M.J.