Crystal structure of the bir domain of mliap bound to gdc0152
PDB DOI: 10.2210/pdb3uw5/pdb
Classification: Apoptosis Inhibitor Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-11-30 Deposition Author(s): Hymowitz, S.G. , Maurer, B.
Crystal structure of the bir domain of mliap bound to gdc0152
Primary Citation of Related Structures: 3UW5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Baculoviral IAP repeat-containing protein 7, Baculoviral IAP repeat-containing protein 4 | A | 116 | Homo Sapiens , Synthetic Construct | GSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL |
| Baculoviral IAP repeat-containing protein 7, Baculoviral IAP repeat-containing protein 4 | B | 116 | Homo Sapiens , Synthetic Construct | GSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL |
| GDC-0152 | Z | 4 | Homo Sapiens , Synthetic Construct | AXPX |
| GDC-0152 | Y | 4 | Homo Sapiens , Synthetic Construct | AXPX |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-11-30 Deposition Author(s): Hymowitz, S.G. , Maurer, B.