3UW5
Crystal structure of the bir domain of mliap bound to gdc0152
PDB DOI: 10.2210/pdb3uw5/pdb
Classification: Apoptosis Inhibitor Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-11-30 Deposition Author(s): Hymowitz, S.G. , Maurer, B.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.71 Å
Crystal structure of the bir domain of mliap bound to gdc0152
Primary Citation of Related Structures: 3UW5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Baculoviral IAP repeat-containing protein 7, Baculoviral IAP repeat-containing protein 4 | A | 116 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL |
| Baculoviral IAP repeat-containing protein 7, Baculoviral IAP repeat-containing protein 4 | B | 116 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL |
| GDC-0152 | Z | 4 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AXPX |
| GDC-0152 | Y | 4 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AXPX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2011-11-30 Deposition Author(s): Hymowitz, S.G. , Maurer, B.