Crystal structure of ciap1 bir3 bound to gdc0152
PDB DOI: 10.2210/pdb3uw4/pdb
Classification: Apoptosis Inhibitor Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-11-30 Deposition Author(s): Hymowitz, S. , Maurer, B.
Crystal structure of ciap1 bir3 bound to gdc0152
Primary Citation of Related Structures: 3UW4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Baculoviral IAP repeat-containing protein 2, Baculoviral IAP repeat-containing protein 4 | A | 92 | Homo Sapiens , Synthetic Construct | GSHMQTHAARMRTFMYWPSSVPVQPEQLAAAGFYYVGRNDDVKCFSCDGGLRCWESGDDPWVEHAKWFPGCEFLIRMKGQEYINNIHLTHSL |
GDC0152 | Z | 4 | Homo Sapiens , Synthetic Construct | AXPX |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-11-30 Deposition Author(s): Hymowitz, S. , Maurer, B.