The c92u mutant c-di-gmp-i riboswitch bound to gpa
PDB DOI: 10.2210/pdb3ud4/pdb
Classification: SIGNALING PROTEIN/RNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-10-27 Deposition Author(s): Smith, K.D. , Strobel, S.A.
The c92u mutant c-di-gmp-i riboswitch bound to gpa
Primary Citation of Related Structures: 3UD4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
U1 small nuclear ribonucleoprotein A | P | 98 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-10-27 Deposition Author(s): Smith, K.D. , Strobel, S.A.