Crystal structure of max-e47
PDB DOI: 10.2210/pdb3u5v/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Mus Musculus
Deposited: 2011-10-11 Deposition Author(s): Ahmadpour, F. , Gloyd, M. , Guarne, A.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of max-e47
Ahmadpour, F. , Gloyd, M. , Guarne, A.
Primary Citation of Related Structures: 3U5V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein max, Transcription factor E2-alpha chimera | A | 76 | Homo Sapiens , Mus Musculus | MGADKRAHHNALERKRRRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPLNHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-10-11 Deposition Author(s): Ahmadpour, F. , Gloyd, M. , Guarne, A.