3TZ1
Crystal structure of the ca2+-saturated c-terminal domain of akazara scallop troponin c in complex with a troponin i fragment
PDB DOI: 10.2210/pdb3tz1/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Lactobacillus Salivarius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-09-26 Deposition Author(s): Kato, Y.S. , Ohtsuki, I. , Tanokura, M. , Yumoto, F.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of the ca2+-saturated c-terminal domain of akazara scallop troponin c in complex with a troponin i fragment
Kato, Y.S. , Ohtsuki, I. , Tanokura, M. , Yumoto, F.
Primary Citation of Related Structures: 3TZ1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Troponin C | A | 74 | Lactobacillus Salivarius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MEDLDERELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIENMIAETDTDGSGTVDYEEFKCLMMSSDA |
| Troponin I | B | 24 | Lactobacillus Salivarius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GLSPEKKKMLKKLIMQKAAEDLAN |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2011-09-26 Deposition Author(s): Kato, Y.S. , Ohtsuki, I. , Tanokura, M. , Yumoto, F.