3THK
Structure of sh3 chimera with a type ii ligand linked to the chain c-terminal
PDB DOI: 10.2210/pdb3thk/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-08-19 Deposition Author(s): Filimonov, V.V. , Gabdulkhakov, A.G. , Gushchina, L.V. , Nikonov, S.V. , Nikulin, A.D.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Structure of sh3 chimera with a type ii ligand linked to the chain c-terminal
Filimonov, V.V. , Gabdulkhakov, A.G. , Gushchina, L.V. , Nikonov, S.V. , Nikulin, A.D.
Primary Citation of Related Structures: 3THK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spectrin alpha chain, brain | A | 73 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLGG |
| Spectrin alpha chain, brain | B | 73 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLGG |
| Proline-rich peptide | C | 10 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPPVPPYSAG |
| Proline-rich peptide | D | 10 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPPVPPYSAG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2011-08-19 Deposition Author(s): Filimonov, V.V. , Gabdulkhakov, A.G. , Gushchina, L.V. , Nikonov, S.V. , Nikulin, A.D.