Crystal structure of the creosote rubisco activase c-domain
PDB DOI: 10.2210/pdb3thg/pdb
Classification: PROTEIN BINDING Organism(s): Larrea Tridentata
Deposited: 2011-08-18 Deposition Author(s): Fromme, R. , Henderson, J.N. , Kuriata, A.M. , Salvucci, M.E. , Wachter, R.M.
Method: X-RAY DIFFRACTION Resolution: 1.88 Å
Crystal structure of the creosote rubisco activase c-domain
Fromme, R. , Henderson, J.N. , Kuriata, A.M. , Salvucci, M.E. , Wachter, R.M.
Primary Citation of Related Structures: 3THG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic | A | 107 | Larrea Tridentata | GIDPFTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQENVKR |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-08-18 Deposition Author(s): Fromme, R. , Henderson, J.N. , Kuriata, A.M. , Salvucci, M.E. , Wachter, R.M.