Structure of uhrf1 in complex with unmodified h3 n-terminal tail
PDB DOI: 10.2210/pdb3t6r/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-07-29 Deposition Author(s): Jakoncic, J. , Qian, C.M. , Xie, S.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Structure of uhrf1 in complex with unmodified h3 n-terminal tail
Jakoncic, J. , Qian, C.M. , Xie, S.
Primary Citation of Related Structures: 3T6R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase UHRF1 | A | 72 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSAPEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR |
E3 ubiquitin-protein ligase UHRF1 | B | 72 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSAPEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR |
Histone H3.1t N-terminal peptide | D | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTA |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-07-29 Deposition Author(s): Jakoncic, J. , Qian, C.M. , Xie, S.