Lettuce necrotic yellow virus phosphoprotein c-terminal domain
PDB DOI: 10.2210/pdb3t4r/pdb
Classification: VIRAL PROTEIN Organism(s): Lettuce Necrotic Yellows Virus
Deposited: 2011-07-26 Deposition Author(s): Jamin, M. , Martinez, N. , Tarbouriech, N.
Lettuce necrotic yellow virus phosphoprotein c-terminal domain
Jamin, M. , Martinez, N. , Tarbouriech, N.
Primary Citation of Related Structures: 3T4R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phosphoprotein | A | 81 | Lettuce Necrotic Yellows Virus | MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-07-26 Deposition Author(s): Jamin, M. , Martinez, N. , Tarbouriech, N.