Crystal structure of nak channel d66y mutant
PDB DOI: 10.2210/pdb3t1c/pdb
Classification: MEMBRANE PROTEIN Organism(s): Bacillus Cereus
Deposited: 2011-07-21 Deposition Author(s): Jiang, Y. , Raghunathan, S. , Sauer, D.B. , Zeng, W.
Crystal structure of nak channel d66y mutant
Jiang, Y. , Raghunathan, S. , Sauer, D.B. , Zeng, W.
Primary Citation of Related Structures: 3T1C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel protein | A | 97 | Bacillus Cereus | MAKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
| Potassium channel protein | B | 97 | Bacillus Cereus | MAKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-07-21 Deposition Author(s): Jiang, Y. , Raghunathan, S. , Sauer, D.B. , Zeng, W.