Crystal structure of the bar domain of human amphiphysin, isoform 1
PDB DOI: 10.2210/pdb3sog/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2011-06-30 Deposition Author(s): Allerston, C.K. , Arrowsmith, C.H. , Berridge, G. , Bountra, C. , Chaikuad, A. , Cooper, C.D.O. , Edwards, A. , Gileadi, O. , Krojer, T. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Vollmar, M. , Von Delft, F. , Weigelt, J.
Crystal structure of the bar domain of human amphiphysin, isoform 1
Allerston, C.K. , Arrowsmith, C.H. , Berridge, G. , Bountra, C. , Chaikuad, A. , Cooper, C.D.O. , Edwards, A. , Gileadi, O. , Krojer, T. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Vollmar, M. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 3SOG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amphiphysin | A | 205 | Homo Sapiens | SMTKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-30 Deposition Author(s): Allerston, C.K. , Arrowsmith, C.H. , Berridge, G. , Bountra, C. , Chaikuad, A. , Cooper, C.D.O. , Edwards, A. , Gileadi, O. , Krojer, T. , Savitsky, P. , Structural Genomics Consortium (Sgc) , Vollmar, M. , Von Delft, F. , Weigelt, J.