Crystal structure of human 14-3-3 sigma c38n/n166h in complex with task-3 peptide and stabilizer fusicoccin a-thf
PDB DOI: 10.2210/pdb3smn/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-06-28 Deposition Author(s): Anders, C. , Ottmann, C. , Schumacher, B.
Crystal structure of human 14-3-3 sigma c38n/n166h in complex with task-3 peptide and stabilizer fusicoccin a-thf
Anders, C. , Ottmann, C. , Schumacher, B.
Primary Citation of Related Structures: 3SMN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 14-3-3 protein sigma | A | 236 | Homo Sapiens , Synthetic Construct | GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSNEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT |
| TASK-3 peptide | P | 6 | Homo Sapiens , Synthetic Construct | KRRKSV |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-28 Deposition Author(s): Anders, C. , Ottmann, C. , Schumacher, B.