Crystal structure analysis of trf2-dbd-dna complex
PDB DOI: 10.2210/pdb3sjm/pdb
Classification: DNA/DNA binding protein Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-06-21 Deposition Author(s): Chen, J.H. , Nair, S.K. , Sliverman, S.K. , Xiao, Y.
Crystal structure analysis of trf2-dbd-dna complex
Chen, J.H. , Nair, S.K. , Sliverman, S.K. , Xiao, Y.
Primary Citation of Related Structures: 3SJM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Telomeric repeat-binding factor 2 | A | 64 | Homo Sapiens , Synthetic Construct | GSHMTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN |
Telomeric repeat-binding factor 2 | B | 64 | Homo Sapiens , Synthetic Construct | GSHMTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-21 Deposition Author(s): Chen, J.H. , Nair, S.K. , Sliverman, S.K. , Xiao, Y.