Structure of glycosylated human glutaminyl cyclase
PDB DOI: 10.2210/pdb3si0/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2011-06-17 Deposition Author(s): Carrillo, D. , Parthier, C. , Stubbs, M.T.
Structure of glycosylated human glutaminyl cyclase
Carrillo, D. , Parthier, C. , Stubbs, M.T.
Primary Citation of Related Structures: 3SI0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glutaminyl-peptide cyclotransferase | A | 330 | Homo Sapiens | HHHHHHEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-06-17 Deposition Author(s): Carrillo, D. , Parthier, C. , Stubbs, M.T.