3S8L
Protein-ligand interactions: thermodynamic effects associated with increasing hydrophobic surface area
PDB DOI: 10.2210/pdb3s8l/pdb
Classification: SIGNALING PROTEIN/ANTAGONIST Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-05-29 Deposition Author(s): Clements, J.H. , Stephen, F.M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.71 Å
Protein-ligand interactions: thermodynamic effects associated with increasing hydrophobic surface area
Clements, J.H. , Stephen, F.M.
Primary Citation of Related Structures: 3S8L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Growth factor receptor-bound protein 2 | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH |
| pYAc4cN | B | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XYXNX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2011-05-29 Deposition Author(s): Clements, J.H. , Stephen, F.M.