The structure of a peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei
PDB DOI: 10.2210/pdb3s6m/pdb
Classification: ISOMERASE Organism(s): Burkholderia Pseudomallei
Deposited: 2011-05-25 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
The structure of a peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 3S6M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase | A | 167 | Burkholderia Pseudomallei | GPGSMVELHTNHGVIKLELDEAKAPKTVENFLNYVKKGHYDGTIFHRVINGFMIQGGGFEPGLKQKPTDAPIANEANNGLKNDTYTIAMARTNDPHSATAQFFINVNDNEFLNHSSPTPQGWGYAVFGKVVEGQDIVDKIKAVKTGSKGFHQDVPNDDVVIEKAVVV |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-05-25 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)