1.5 angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
PDB DOI: 10.2210/pdb3ry4/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2011-05-11 Deposition Author(s): Farrugia, W. , Hogarth, P.M. , Ramsland, P.A.
1.5 angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
Farrugia, W. , Hogarth, P.M. , Ramsland, P.A.
Primary Citation of Related Structures: 3RY4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Low affinity immunoglobulin gamma Fc region receptor II-a | A | 170 | Homo Sapiens | APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLFEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-05-11 Deposition Author(s): Farrugia, W. , Hogarth, P.M. , Ramsland, P.A.