Structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824
PDB DOI: 10.2210/pdb3r5l/pdb
Classification: OXIDOREDUCTASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2011-03-18 Deposition Author(s): Barry, C.E. , Boshoff, H.I.M. , Bursulaya, B. , Cellitti, S.E. , Cherian, J. , Choi, I. , Dick, T. , Geierstanger, B.H. , Gurumurthy, M. , Jones, D.H. , Lee, Y.S. , Manjunatha, U.H. , Mukherjee, T. , Nayyar, A. , Niyomrattanakit, P. , Shaffer, J. , Spraggon, G.
Structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824
Barry, C.E. , Boshoff, H.I.M. , Bursulaya, B. , Cellitti, S.E. , Cherian, J. , Choi, I. , Dick, T. , Geierstanger, B.H. , Gurumurthy, M. , Jones, D.H. , Lee, Y.S. , Manjunatha, U.H. , Mukherjee, T. , Nayyar, A. , Niyomrattanakit, P. , Shaffer, J. , Spraggon, G.
Primary Citation of Related Structures: 3R5L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Deazaflavin-dependent nitroreductase | A | 122 | Mycobacterium Tuberculosis | GRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-18 Deposition Author(s): Barry, C.E. , Boshoff, H.I.M. , Bursulaya, B. , Cellitti, S.E. , Cherian, J. , Choi, I. , Dick, T. , Geierstanger, B.H. , Gurumurthy, M. , Jones, D.H. , Lee, Y.S. , Manjunatha, U.H. , Mukherjee, T. , Nayyar, A. , Niyomrattanakit, P. , Shaffer, J. , Spraggon, G.