2.2 angstrom crystal structure of c terminal truncated human apolipoprotein a-i reveals the assembly of hdl by dimerization.
PDB DOI: 10.2210/pdb3r2p/pdb
Classification: LIPID TRANSPORT Organism(s): Homo Sapiens
Deposited: 2011-03-14 Deposition Author(s): Atkinson, D. , Mei, X.
2.2 angstrom crystal structure of c terminal truncated human apolipoprotein a-i reveals the assembly of hdl by dimerization.
Primary Citation of Related Structures: 3R2P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Apolipoprotein A-I | A | 185 | Homo Sapiens | GDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKEN |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-14 Deposition Author(s): Atkinson, D. , Mei, X.