3QZT
Crystal structure of bptf bromo in complex with histone h4k16ac - form ii
PDB DOI: 10.2210/pdb3qzt/pdb
Classification: TRANSCRIPTION/NUCLEAR PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-03-07 Deposition Author(s): Li, H. , Patel, D.J. , Ruthenburg, A.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Crystal structure of bptf bromo in complex with histone h4k16ac - form ii
Li, H. , Patel, D.J. , Ruthenburg, A.J.
Primary Citation of Related Structures: 3QZT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nucleosome-remodeling factor subunit BPTF | A | 115 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA |
| Histone H4 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KGGAKRHRKV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-07 Deposition Author(s): Li, H. , Patel, D.J. , Ruthenburg, A.J.