Crystal structure of bptf bromo in complex with histone h4k16ac - form i
PDB DOI: 10.2210/pdb3qzs/pdb
Classification: TRANSCRIPTION/NUCLEAR PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-03-07 Deposition Author(s): Li, H. , Patel, D.J. , Ruthenburg, A.J.
Crystal structure of bptf bromo in complex with histone h4k16ac - form i
Li, H. , Patel, D.J. , Ruthenburg, A.J.
Primary Citation of Related Structures: 3QZS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nucleosome-remodeling factor subunit BPTF | A | 115 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTAIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA |
Nucleosome-remodeling factor subunit BPTF | B | 115 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTAIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA |
Histone H4 | C | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KGGAKRHRKV |
Histone H4 | D | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KGGAKRHRKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-07 Deposition Author(s): Li, H. , Patel, D.J. , Ruthenburg, A.J.