Structure of treponema denticola factor h binding protein (fhbb), selenomethionine derivative
PDB DOI: 10.2210/pdb3qz0/pdb
Classification: PROTEIN BINDING Organism(s): Treponema Denticola
Deposited: 2011-03-04 Deposition Author(s): Bell, J.K. , Burgner, J.W. , Conrad, D.H. , Heroux, A. , Marconi, R.T. , Mcdowell, J.V. , Miller, D.P.
Structure of treponema denticola factor h binding protein (fhbb), selenomethionine derivative
Bell, J.K. , Burgner, J.W. , Conrad, D.H. , Heroux, A. , Marconi, R.T. , Mcdowell, J.V. , Miller, D.P.
Primary Citation of Related Structures: 3QZ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Factor H binding protein | A | 93 | Treponema Denticola | MAHHHHHHVDDDDKTFKMNTAQKAHYEKFINALENELKTRHIPAGAVIDMLAEINTEALALDYQIVDKKPGTSIAQGTKAAALRKRFIPKKIK |
| Factor H binding protein | B | 93 | Treponema Denticola | MAHHHHHHVDDDDKTFKMNTAQKAHYEKFINALENELKTRHIPAGAVIDMLAEINTEALALDYQIVDKKPGTSIAQGTKAAALRKRFIPKKIK |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-03-04 Deposition Author(s): Bell, J.K. , Burgner, J.W. , Conrad, D.H. , Heroux, A. , Marconi, R.T. , Mcdowell, J.V. , Miller, D.P.