L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k367a
PDB DOI: 10.2210/pdb3qvx/pdb
Classification: ISOMERASE Organism(s): Archaeoglobus Fulgidus
Deposited: 2011-02-26 Deposition Author(s): Neelon, K. , Roberts, M.F. , Stec, B.
L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k367a
Neelon, K. , Roberts, M.F. , Stec, B.
Primary Citation of Related Structures: 3QVX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myo-inositol-1-phosphate synthase (Ino1) | A | 392 | Archaeoglobus Fulgidus | MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFASPMDTNVINTHEQFVVLKEWYSNLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-26 Deposition Author(s): Neelon, K. , Roberts, M.F. , Stec, B.