Crystal structure analysis of h185f mutant of human clic1
PDB DOI: 10.2210/pdb3qr6/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2011-02-17 Deposition Author(s): Achilonu, I.A. , Dirr, H.W. , Fanucchi, S. , Fernandes, M.A.
Crystal structure analysis of h185f mutant of human clic1
Achilonu, I.A. , Dirr, H.W. , Fanucchi, S. , Fernandes, M.A.
Primary Citation of Related Structures: 3QR6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Chloride intracellular channel protein 1 | A | 241 | Homo Sapiens | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLFIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK | 
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-17 Deposition Author(s): Achilonu, I.A. , Dirr, H.W. , Fanucchi, S. , Fernandes, M.A.
 
                  