Crystal structure of the salmonella transcriptional regulator slya
PDB DOI: 10.2210/pdb3qpt/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2011-02-14 Deposition Author(s): Dolan, K.T. , Duguid, E.M.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Crystal structure of the salmonella transcriptional regulator slya
Primary Citation of Related Structures: 3QPT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulator slyA | A | 147 | Salmonella Enterica | SNAMESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSHD |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-14 Deposition Author(s): Dolan, K.T. , Duguid, E.M.