Crystal structure of the transcription factor amrz in complex with the 18 base pair amrz1 binding site
PDB DOI: 10.2210/pdb3qoq/pdb
Classification: Transcription/DNA Organism(s): Pseudomonas Aeruginosa , Synthetic Construct
Deposited: 2011-02-10 Deposition Author(s): Hollis, T. , Pryor Jr., E.E. , Wozniak, D.J.
Method: X-RAY DIFFRACTION Resolution: 3.1 Å
Crystal structure of the transcription factor amrz in complex with the 18 base pair amrz1 binding site
Hollis, T. , Pryor Jr., E.E. , Wozniak, D.J.
Primary Citation of Related Structures: 3QOQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alginate and motility regulator Z | A | 69 | Pseudomonas Aeruginosa , Synthetic Construct | GPHMRPLKQATPTYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDNLGV |
| Alginate and motility regulator Z | B | 69 | Pseudomonas Aeruginosa , Synthetic Construct | GPHMRPLKQATPTYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDNLGV |
| Alginate and motility regulator Z | C | 69 | Pseudomonas Aeruginosa , Synthetic Construct | GPHMRPLKQATPTYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDNLGV |
| Alginate and motility regulator Z | D | 69 | Pseudomonas Aeruginosa , Synthetic Construct | GPHMRPLKQATPTYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDNLGV |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-02-10 Deposition Author(s): Hollis, T. , Pryor Jr., E.E. , Wozniak, D.J.