Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and pyrimidinol carboxylic acid inhibitor
PDB DOI: 10.2210/pdb3qin/pdb
Classification: TRANSFERASE, HYDROLASE/INHIBITOR Organism(s): Escherichia Coli (Strain K12) , Human Immunodeficiency Virus Type 1 Group M Subtype B , Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Hxb2)
Deposited: 2011-01-27 Deposition Author(s): Kirschberg, T.A. , Lansdon, E.B.
Method: X-RAY DIFFRACTION Resolution: 1.6967 Å
Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and pyrimidinol carboxylic acid inhibitor
Kirschberg, T.A. , Lansdon, E.B.
Primary Citation of Related Structures: 3QIN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Fusion protein of HIV-1 RNase H p15 with engineered E. coli loop | A | 150 | Escherichia Coli (Strain K12) , Human Immunodeficiency Virus Type 1 Group M Subtype B , Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Hxb2) | MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWKTADKKPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-27 Deposition Author(s): Kirschberg, T.A. , Lansdon, E.B.