Crystal structure of the first pdz domain of prex1
PDB DOI: 10.2210/pdb3qik/pdb
Classification: HYDROLASE REGULATOR Organism(s): Homo Sapiens
Deposited: 2011-01-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Li, Y. , Park, H. , Shen, L. , Structural Genomics Consortium (Sgc) , Tempel, W. , Tong, Y. , Weigelt, J.
Crystal structure of the first pdz domain of prex1
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Li, Y. , Park, H. , Shen, L. , Structural Genomics Consortium (Sgc) , Tempel, W. , Tong, Y. , Weigelt, J.
Primary Citation of Related Structures: 3QIK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein | A | 101 | Homo Sapiens | GKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Li, Y. , Park, H. , Shen, L. , Structural Genomics Consortium (Sgc) , Tempel, W. , Tong, Y. , Weigelt, J.