2.1a resolution structure of the chxr receiver domain containing i3c from chlamydia trachomatis
PDB DOI: 10.2210/pdb3q7s/pdb
Classification: TRANSCRIPTION Organism(s): Chlamydia Trachomatis
Deposited: 2011-01-05 Deposition Author(s): Battaile, K.P. , Hefty, P.S. , Hickey, J. , Hu, L. , Lovell, S. , Middaugh, C.R.
2.1a resolution structure of the chxr receiver domain containing i3c from chlamydia trachomatis
Battaile, K.P. , Hefty, P.S. , Hickey, J. , Hu, L. , Lovell, S. , Middaugh, C.R.
Primary Citation of Related Structures: 3Q7S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulatory protein | A | 121 | Chlamydia Trachomatis | MHHHHHHRTAGPKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPREIRSPKSLEGSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQHSL |
| Transcriptional regulatory protein | B | 121 | Chlamydia Trachomatis | MHHHHHHRTAGPKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPREIRSPKSLEGSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQHSL |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-01-05 Deposition Author(s): Battaile, K.P. , Hefty, P.S. , Hickey, J. , Hu, L. , Lovell, S. , Middaugh, C.R.