Ethr from mycobacterium tuberculosis in complex with compound bdm31379
PDB DOI: 10.2210/pdb3q0u/pdb
Classification: TRANSCRIPTION/TRANSCRIPTION INHIBITOR Organism(s): Mycobacterium Tuberculosis
Deposited: 2010-12-16 Deposition Author(s): Baulard, A. , Brodin, P. , Carette, X. , Christophe, T. , Demirkaya, F. , Deprez, B. , Desroses, M. , Dirie, B. , Flipo, M. , Jeon, H.K. , Lens, Z. , Leroux, F. , Locht, C. , Piveteau, C. , Rucktooa, P. , Villeret, V. , Willand, N.
Ethr from mycobacterium tuberculosis in complex with compound bdm31379
Baulard, A. , Brodin, P. , Carette, X. , Christophe, T. , Demirkaya, F. , Deprez, B. , Desroses, M. , Dirie, B. , Flipo, M. , Jeon, H.K. , Lens, Z. , Leroux, F. , Locht, C. , Piveteau, C. , Rucktooa, P. , Villeret, V. , Willand, N.
Primary Citation of Related Structures: 3Q0U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional regulator EthR | A | 236 | Mycobacterium Tuberculosis | MGSSHHHHHHSSGLVPRGSHMTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-12-16 Deposition Author(s): Baulard, A. , Brodin, P. , Carette, X. , Christophe, T. , Demirkaya, F. , Deprez, B. , Desroses, M. , Dirie, B. , Flipo, M. , Jeon, H.K. , Lens, Z. , Leroux, F. , Locht, C. , Piveteau, C. , Rucktooa, P. , Villeret, V. , Willand, N.