Structural and functional analysis of phosphothreonine-dependent fha domain interactions
PDB DOI: 10.2210/pdb3poa/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Taenia Saginata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-11-22 Deposition Author(s): Pennell, S. , Smerdon, S.J.
Structural and functional analysis of phosphothreonine-dependent fha domain interactions
Primary Citation of Related Structures: 3POA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative uncharacterized protein TB39.8 | A | 100 | Taenia Saginata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SAGTSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMHPLT |
synthetic phosphopeptide | B | 12 | Taenia Saginata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DTAPTEKIAYKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-11-22 Deposition Author(s): Pennell, S. , Smerdon, S.J.