Crystal structure of the tudor domain of human tudor domain-containing protein 3
PDB DOI: 10.2210/pdb3pmt/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2010-11-18 Deposition Author(s): Arrowsmith, C.H. , Bian, C.B. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Guo, Y.H. , Kania, J. , Lam, R. , Min, J. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Xu, C.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of the tudor domain of human tudor domain-containing protein 3
Arrowsmith, C.H. , Bian, C.B. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Guo, Y.H. , Kania, J. , Lam, R. , Min, J. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Xu, C.
Primary Citation of Related Structures: 3PMT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tudor domain-containing protein 3 | A | 59 | Salmonella Enterica | AKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPIQTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-11-18 Deposition Author(s): Arrowsmith, C.H. , Bian, C.B. , Bochkarev, A. , Bountra, C. , Edwards, A.M. , Guo, Y.H. , Kania, J. , Lam, R. , Min, J. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Xu, C.