Crystal structure of carcinoscorpius rotundicauda serine protease inhibitor domain 1
PDB DOI: 10.2210/pdb3pis/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Carcinoscorpius Rotundicauda
Deposited: 2010-11-08 Deposition Author(s): Giri, P.K. , Sivaraman, J. , Tang, X.H.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of carcinoscorpius rotundicauda serine protease inhibitor domain 1
Giri, P.K. , Sivaraman, J. , Tang, X.H.
Primary Citation of Related Structures: 3PIS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kazal-type serine protease inhibitor SPI-1 | D | 42 | Carcinoscorpius Rotundicauda | GSCPHTYKPVCGANGEVYDNECFLNKAGIEPAESWETCRGHE |
| Kazal-type serine protease inhibitor SPI-1 | A | 42 | Carcinoscorpius Rotundicauda | GSCPHTYKPVCGANGEVYDNECFLNKAGIEPAESWETCRGHE |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-11-08 Deposition Author(s): Giri, P.K. , Sivaraman, J. , Tang, X.H.