Crystal structure of bs-cspb in complex with r(gucuuua)
PDB DOI: 10.2210/pdb3pf4/pdb
Classification: GENE REGULATION/RNA Organism(s): Bacillus Subtilis , Synthetic Construct
Deposited: 2010-10-27 Deposition Author(s): Heinemann, U. , Max, K.E.A. , Sachs, R.
Method: X-RAY DIFFRACTION Resolution: 1.38 Å
Crystal structure of bs-cspb in complex with r(gucuuua)
Heinemann, U. , Max, K.E.A. , Sachs, R.
Primary Citation of Related Structures: 3PF4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cold shock protein cspB | A | 67 | Bacillus Subtilis , Synthetic Construct | MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA |
| Cold shock protein cspB | B | 67 | Bacillus Subtilis , Synthetic Construct | MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| hexaribonucleotide (rGUCUUUA) | r | 7 | NA | GUCUUUA |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-10-27 Deposition Author(s): Heinemann, U. , Max, K.E.A. , Sachs, R.