Crystal structure of hiv-1 l76v protease in complex with the protease inhibitor darunavir.
PDB DOI: 10.2210/pdb3oy4/pdb
Classification: Hydrolase/Hydrolase Inhibitor Organism(s): Human Immunodeficiency Virus Type 1
Deposited: 2010-09-22 Deposition Author(s): Bandaranayake, R.M. , Nalivaika, E.A. , Schiffer, C.A.
Crystal structure of hiv-1 l76v protease in complex with the protease inhibitor darunavir.
Bandaranayake, R.M. , Nalivaika, E.A. , Schiffer, C.A.
Primary Citation of Related Structures: 3OY4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 PROTEASE | A | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVVVGPTPVNIIGRNLLTQIGCTLNF |
| HIV-1 PROTEASE | B | 99 | Human Immunodeficiency Virus Type 1 | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVVVGPTPVNIIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-09-22 Deposition Author(s): Bandaranayake, R.M. , Nalivaika, E.A. , Schiffer, C.A.