Crystal structure of staphylococcal nuclease variant delta+phs v66r at cryogenic temperature
PDB DOI: 10.2210/pdb3owf/pdb
Classification: HYDROLASE Organism(s): Staphylococcus Aureus
Deposited: 2010-09-17 Deposition Author(s): Garcia-Moreno E., B. , Heroux, A. , Khangulov, V. , Schlessman, J.L.
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of staphylococcal nuclease variant delta+phs v66r at cryogenic temperature
Garcia-Moreno E., B. , Heroux, A. , Khangulov, V. , Schlessman, J.L.
Primary Citation of Related Structures: 3OWF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thermonuclease | A | 143 | Staphylococcus Aureus | ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMRENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2010-09-17 Deposition Author(s): Garcia-Moreno E., B. , Heroux, A. , Khangulov, V. , Schlessman, J.L.