3OV1
Crystal structure of the grb2 sh2 domain in complex with a pyxn-derived tripeptide
PDB DOI: 10.2210/pdb3ov1/pdb
Classification: SIGNALING PROTEIN/ANTAGONIST Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-09-15 Deposition Author(s): Clements, J.H. , Martin, S.F.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of the grb2 sh2 domain in complex with a pyxn-derived tripeptide
Primary Citation of Related Structures: 3OV1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Growth factor receptor-bound protein 2 | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH |
| PYAC3CN | B | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XYXNX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2010-09-15 Deposition Author(s): Clements, J.H. , Martin, S.F.